PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID C.cajan_15673
Common NameKK1_016134
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Cajanus
Family CPP
Protein Properties Length: 518aa    MW: 55751.9 Da    PI: 7.6942
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
C.cajan_15673genomeIIPGView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR46.11e-144685242
            TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                   ++k+CnCk+skClk+YCeCfa+g +C+  C+C +C+N+ e+
  C.cajan_15673 46 KQKQCNCKHSKCLKLYCECFASGIYCDG-CNCVNCFNNVEN 85
                   89**************************.********9875 PP

2TCR51.12.6e-16130169140
            TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                    k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  C.cajan_15673 130 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNFE 169
                    589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011141.2E-174585IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.13846170IPR005172CRC domain
PfamPF036382.5E-114782IPR005172CRC domain
SMARTSM011148.4E-20130171IPR033467Tesmin/TSO1-like CXC domain
PfamPF036389.7E-13133168IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 518 aa     Download sequence    Send to blast
MPPAPQPRPP VVLPQPPPAA VRVGKPESPK SRSRPGFDIK EATPKKQKQC NCKHSKCLKL  60
YCECFASGIY CDGCNCVNCF NNVENEAARR EAVEATLERN PNAFRPKIAS SPHGTRDSRE  120
DAGEVLILGK HNKGCHCKKS GCLKKYCECF QANILCSENC KCMDCKNFEG SEERQALFHG  180
DQNNNMVYIQ QAANAAITGA IGSSGFSSPP ISKKRKGQEL LFGPTVKDPS VGRLGQQANN  240
VRVPAPSSSL SPVPGARAGP ATLGPSKLMY RSLLADIIQP QHLKELCSVL VLVSGQAAKT  300
FTDQKNLMDK HAEDQTETSL ASSTQEQLPS QKEANVEKAM ADDDCSSANQ TDKISPDNSC  360
SDGADVPKGR PMSPGTLALM CDEQDTMFMT GASPVGSRAH ACNTSLQPPY GQGMTEVYAE  420
QERIVLTKFR DFLNRVITMG EINETKCSSL ARSELESQKD PNMNCTGNAS TETVHQQGAT  480
NNGVAKAAGT DVTLTSTSLF PGSLVPENGD TYPKKVEK
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150341e-178AP015034.1 Vigna angularis var. angularis DNA, chromosome 1, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003524396.10.0PREDICTED: protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD10.0TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A151T3M60.0A0A151T3M6_CAJCA; Protein lin-54
STRINGGLYMA05G35561.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF26263379
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-163Tesmin/TSO1-like CXC domain-containing protein